Protein Info for GFF1304 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG004136: Prepilin peptidase dependent protein C precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07963: N_methyl
  • amino acids 6 to 30 (25 residues), 27 bits, 2.5e-10
• TIGR02532: prepilin-type N-terminal cleavage/methylation domain
  • amino acids 8 to 30 (23 residues), 26.6 bits, 1.9e-10
• PF12528: T2SSppdC
  • amino acids 33 to 104 (72 residues), 100.9 bits, E=5.6e-33

Best Hits

Swiss-Prot: 70% identical to PPDC_ECOLI: Prepilin peptidase-dependent protein C (ppdC) from Escherichia coli (strain K12)

KEGG orthology group: K02681, prepilin peptidase dependent protein C (inferred from 96% identity to stt:t2905)

Predicted SEED Role

"FIG004136: Prepilin peptidase dependent protein C precursor"

Protein Sequence (106 amino acids)

>GFF1304 FIG004136: Prepilin peptidase dependent protein C precursor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSHPLNLQRGFSLPEVLVAMVLMVMIVTALSGYQRVLMHSFALRHQYLQIWRQAWQQTAL
YPFSPADDWKANRMQTTQSGCVSISVTMVSPSGRQGQMTRLHCPNR