Protein Info for PS417_06615 in Pseudomonas simiae WCS417

Updated annotation (from data): ABC transporter for branched-chain amino acids, substrate-binding component
Rationale: Important for L-leucine utilization and detrimental for L-valine utilization. Not important for isoleucine utilization, but lose homologs are (AO353_17125, Pf1N1B4_3218), so probably transporters isoleucine as well. Close homologs are mildly important for phenylalanine utilization (i.e., PP_1141), so may transport phenylalanine as well.
Original annotation: leucine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 29 to 363 (335 residues), 203.1 bits, see alignment E=1.6e-63 PF13433: Peripla_BP_5" amino acids 30 to 349 (320 residues), 82.9 bits, see alignment E=3.6e-27 PF01094: ANF_receptor" amino acids 52 to 364 (313 residues), 104.6 bits, see alignment E=8.9e-34

Best Hits

Swiss-Prot: 69% identical to BRAC_PSEAE: Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein (braC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 99% identity to pfs:PFLU1346)

MetaCyc: 57% identical to branched chain amino acid/phenylalanine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"High-affinity leucine-specific transport system, periplasmic binding protein LivK (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0Q9 at UniProt or InterPro

Protein Sequence (375 amino acids)

>PS417_06615 ABC transporter for branched-chain amino acids, substrate-binding component (Pseudomonas simiae WCS417)
MNKATKQISKLFAAMVLAGVAGHSFAADTIKIGIAGPKTGPVTQYGDMQFMGAKQAIADI
NAKGGVDGKMLEAKEYDDACDPKQAVAVANKVVNDGVKFVVGHLCSSSTQPASDIYEDEG
VIMITPAATSPEITARGYKLIFRTIGLDSAQGPAAGNYIADHVKPKIVAVLHDKQQYGEG
IATAVKQTLEKKGTKVAVFEGLNAGDKDFSSIIQKLKQANVDFVYYGGYHPELGLILRQA
KEKGLNAKFMGPEGVGNDSISQIAQGASEGLLVTLPKSFDTDPANKAIVEEFAKNKQDPT
GPFVFPAYSAIEVIAGGIKAAKSEDTAKVAEAIHAGTFKTPTGDLSFDAKGDLKDFKFVV
YEWHFGKPKTEVSPQ