Protein Info for GFF130 in Pseudomonas sp. DMC3

Annotation: HTH-type transcriptional regulator CdhR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 transmembrane" amino acids 25 to 31 (7 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 21 to 184 (164 residues), 57.1 bits, see alignment E=3e-19 PF12833: HTH_18" amino acids 246 to 323 (78 residues), 79.1 bits, see alignment E=3.7e-26 PF00165: HTH_AraC" amino acids 285 to 320 (36 residues), 28.7 bits, see alignment 1.7e-10

Best Hits

Swiss-Prot: 44% identical to CDHR_PSEAE: HTH-type transcriptional regulator CdhR (cdhR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 99% identity to pfo:Pfl01_5236)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (367 amino acids)

>GFF130 HTH-type transcriptional regulator CdhR (Pseudomonas sp. DMC3)
MTSFNSGAQPQNRAPQSIGFLLLDNFTLISLASAVEPLRMANQLSGRELYRWSTLTVDGG
QVWASDGLQITPDASMHKAPPLDTVIVCGGIGIQRTVTREHVSWLQSQARQSKRLGAVCT
GSWALACAGLLDGFDCSVHWECLAAMQEAFPRVAMSTRLFTLDRNRFTSSGGTAPLDMML
HLISRDHGRELSAAISEMFVYERIRNEQDHQRVPLKHMLGTNQPKLQEIVALMEANLEEP
IDLDELAVYVAVSRRQLERLFQKYLHCSPSRYYLKLRLIRARQLLKQTPMSIIEVASVCG
FVSTPHFSKCYREYFGIPPRDERVGSNTTQQVAMLPLPQAIVMSPLSGPMSALSQARNES
TFASVRL