Protein Info for GFF1299 in Variovorax sp. SCN45

Annotation: DNA ligase (NAD(+)) (EC 6.5.1.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 694 TIGR00575: DNA ligase, NAD-dependent" amino acids 14 to 683 (670 residues), 803.7 bits, see alignment E=6.5e-246 PF22745: Nlig-Ia" amino acids 15 to 55 (41 residues), 32.7 bits, see alignment 3.8e-11 PF01653: DNA_ligase_aden" amino acids 72 to 335 (264 residues), 284.8 bits, see alignment E=2.6e-88 PF03120: DNA_ligase_OB" amino acids 339 to 411 (73 residues), 114.4 bits, see alignment E=6.9e-37 PF03119: DNA_ligase_ZBD" amino acids 428 to 455 (28 residues), 47.9 bits, see alignment (E = 3.8e-16) PF14520: HHH_5" amino acids 471 to 522 (52 residues), 21.6 bits, see alignment 1e-07 amino acids 536 to 581 (46 residues), 24.1 bits, see alignment 1.7e-08 PF12826: HHH_2" amino acids 531 to 594 (64 residues), 91.8 bits, see alignment E=9.7e-30 PF00533: BRCT" amino acids 614 to 686 (73 residues), 49.9 bits, see alignment E=1.2e-16 PF12738: PTCB-BRCT" amino acids 631 to 679 (49 residues), 25.4 bits, see alignment 4.5e-09

Best Hits

Swiss-Prot: 76% identical to DNLJ_POLSJ: DNA ligase (ligA) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K01972, DNA ligase (NAD+) [EC: 6.5.1.2] (inferred from 95% identity to vpe:Varpa_3223)

Predicted SEED Role

"DNA ligase (EC 6.5.1.2)" in subsystem DNA Repair Base Excision (EC 6.5.1.2)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (694 amino acids)

>GFF1299 DNA ligase (NAD(+)) (EC 6.5.1.2) (Variovorax sp. SCN45)
MTSRDEAAREAAALSEQLHRHANLYYVLDAPELPDAEYDKLFQRLQAIEAEYPDLRTPDS
PTQRVGGKVLDGFTKVRHKVPMLSIRTETDITPGGASAFDARVRKELGLAEDGPQVAYVC
ELKFDGLAMNLRYENGVLVQAATRGDGEVGEEVTQNIRTVREIPLRLNGKAPPVVEVRGE
VYMKRADFDALNERQREKIAAGQKNEKVFVNPRNAAAGAVRQLDPAIAAARPLSFFAYGL
GEVTPASEGGPDCPTQFDWLAQFKAWGFPVAQQTARATGAIELIAFHENIGRQRDALPYD
IDGVVYKVDSIELQRQLGFVTREPRWAVAHKYPAQEQLTEVLGIEIQVGRTGKLTPVAKL
APVFVGGVTVTNATLHNEDEARRKDVRVGDTVIVRRAGDVIPEVVGVVPESLAKPDDQRG
PLFTMPHKCPVCGSEAVREEGEVDYRCTGGLFCAAQRKEAILHFAARRAVDVDGLGDKLV
EQLVDANLIRTLPDLYKLGFTTLAGLDRMAEKSAKNLVDALEASKKTTLPRFLFGLGIRH
VGESTAKDLAKHFGKLDGIMDATEEQLLEVNDVGPVVAQSLRTFFDQPHNREVVEQLRAC
GLTWEEGEPEARAPKPLAGLTFVITGTLPTLGRDEAKDKLEAAGAKVAGSVSKKTHYLVA
GEDAGSKLDKAREIGVEVIDEARMLEILAKGAVD