Protein Info for GFF1294 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Ubiquinol--cytochrome c reductase, cytochrome B subunit (EC 1.10.2.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 46 to 70 (25 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 159 to 183 (25 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details amino acids 344 to 361 (18 residues), see Phobius details amino acids 367 to 386 (20 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details amino acids 430 to 449 (20 residues), see Phobius details PF00033: Cytochrome_B" amino acids 36 to 224 (189 residues), 227.3 bits, see alignment E=2.2e-71 PF13631: Cytochrom_B_N_2" amino acids 106 to 276 (171 residues), 151 bits, see alignment E=5e-48 PF00032: Cytochrom_B_C" amino acids 290 to 340 (51 residues), 46.2 bits, see alignment 7.2e-16 amino acids 358 to 439 (82 residues), 78 bits, see alignment E=9e-26

Best Hits

KEGG orthology group: K00412, ubiquinol-cytochrome c reductase cytochrome b subunit [EC: 1.10.2.2] (inferred from 85% identity to pol:Bpro_0822)

Predicted SEED Role

"Ubiquinol--cytochrome c reductase, cytochrome B subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>GFF1294 Ubiquinol--cytochrome c reductase, cytochrome B subunit (EC 1.10.2.2) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAEFKEISPDAPIGQKALNWIDNRFPASKLYKEHLSEYYAPKNFNFWYFFGSLALLVLVI
QIVTGIFLVMHYKPDANLAFASVEYIMRDVPWGWLIRYMHSTGASAFFVVVYLHMFRGLI
YGSYRKPRELVWVFGCAIFLCLMAEAFMGYLLPWGQMSYWGAQVIVNLFSAIPFVGPDLA
LLIRGDYVVGDATLNRFFSFHVIAVPLVLLGLVVAHLIALHEVGSNNPDGVEIKATKDAS
GKPLDGIPFHPYYTVHDILGVSVFLMVFSAIVFFAPEFGGYFLEYNNFIPADPLVTPLHI
APVWYFTPFYSMLRAITTEMMYALVTIVVIAAILGALKAKVSGAIKGGIVIAALVLVALM
LSIDAKFWGVVAMGGAVIILFFLPWLDHSPVKSIRYRPTWNLWLYTVFVINFLVLGYLGV
LPPSPIGERVSQVGTLFYFGFFLLMPWWSRIGEFKPVPQRVTFQPH