Protein Info for GFF1293 in Variovorax sp. SCN45

Annotation: Macrolide export ATP-binding/permease protein MacB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 669 transmembrane" amino acids 294 to 314 (21 residues), see Phobius details amino acids 543 to 569 (27 residues), see Phobius details amino acids 595 to 622 (28 residues), see Phobius details amino acids 628 to 652 (25 residues), see Phobius details PF00005: ABC_tran" amino acids 32 to 180 (149 residues), 110.5 bits, see alignment E=1.5e-35 PF12704: MacB_PCD" amino acids 293 to 511 (219 residues), 165 bits, see alignment E=4.5e-52 PF02687: FtsX" amino acids 548 to 662 (115 residues), 70.2 bits, see alignment E=2.5e-23

Best Hits

Swiss-Prot: 66% identical to MACB_BURP1: Macrolide export ATP-binding/permease protein MacB (macB) from Burkholderia pseudomallei (strain 1710b)

KEGG orthology group: K05685, macrolide transport system ATP-binding/permease protein [EC: 3.6.3.-] (inferred from 92% identity to vpe:Varpa_2701)

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (669 amino acids)

>GFF1293 Macrolide export ATP-binding/permease protein MacB (Variovorax sp. SCN45)
MTQQPQQAEQPLLSLRGIGRSFPSGEQEVQVLKNVDLDIGNGEMLAIVGASGSGKSTLMN
ILGCLDRPSTGIYLVSGKDVGTLDSDALAELRREHFGFIFQRYHLMQHLTATGNVEVPAV
YAGTDSEARDTRARQLLTRLGLGDRTEHRPSQLSGGQQQRVSIARALMNGGQVILADEPT
GALDSKSGQEVIGILRELHAQGHTVIIVTHDMQVASCTERIIEIADGVIVRDRPNVPTVA
APEQSAQADASAAPGGAMTRPKLGIARFSTGWARFAEAFRMAWRSMMAHRMRTALTMLGI
IIGITSVVSIVAIGEGAKRFVLSDIKAIGTNTLDVYPGSDFGDDKAASIRTLTPSDLDAL
AAQPYVHSVTPSTSRNLRLRYRSVDINGSVNGVSDSFFRVRDIQMASGAAFTASDVRHQS
QVVVIDQNTRRKLFPEGTDPLGKIILVGNLPCTVIGVSQEKKNMFGENKSLNIWLPYSTG
ASRLFGQQHFDSITVRIRDDQPTKAAEDSVVKLLTMRHGSKDFFTFNMDSIVKTAERTSQ
SLTLLLSLIAVISLVVGGIGVMNIMLVSVTERTREIGIRMAVGARQSDVLQQFLTEAVLV
CLVGGLIGVTLSYGISFLFSLFVKQWQMIFSMGAVVSAFLCASLIGVLFGYLPARNAARL
DPIEALARE