Protein Info for GFF1291 in Variovorax sp. SCN45

Annotation: Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details PF02600: DsbB" amino acids 10 to 158 (149 residues), 150.4 bits, see alignment E=2.6e-48

Best Hits

Swiss-Prot: 61% identical to DSBB_POLSJ: Disulfide bond formation protein B (dsbB) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K03611, disulfide bond formation protein DsbB (inferred from 89% identity to vap:Vapar_2957)

Predicted SEED Role

"Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (167 amino acids)

>GFF1291 Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation (Variovorax sp. SCN45)
LIDWYFGAPRRAYGLICLACVLMLAFGLYLQHVVGLEPCPMCIVQRYALVLVALFTGLAG
VFRSVGLRFVGGLLALVAAVGGAYTAASQSWLQWYPPEVVSCGRDLYGMIETFPLKRALP
MIFRGGGDCSKIDWSLFGLTLANWSFIAFTVLSLMLIVLLVRSRRAR