Protein Info for GFF1291 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Phage minor tail protein #Phage minor tail protein T

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01715: phage tail assembly protein T
  • amino acids 1 to 87 (87 residues), 126 bits, E=4.1e-41
• PF06223: Phage_tail_T
  • amino acids 6 to 79 (74 residues), 39.4 bits, E=3.3e-14

Best Hits

KEGG orthology group: None (inferred from 99% identity to sec:SC1228)

Predicted SEED Role

No annotation

Protein Sequence (90 amino acids)

>GFF1291 Phage minor tail protein #Phage minor tail protein T (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLAEMSATELGEWAEHFGKNSFSDMLLDAEFATLKSLISGLVTGTHHDAEMFSLITDPES
LHEKTDDELMILGEGITGGVRYGPDSEPGH