Protein Info for GFF1289 in Variovorax sp. SCN45

Annotation: Sulfate transport system permease protein CysW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 68 to 94 (27 residues), see Phobius details amino acids 107 to 133 (27 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 206 to 231 (26 residues), see Phobius details amino acids 251 to 274 (24 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 19 to 278 (260 residues), 340.6 bits, see alignment E=6.9e-106 TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 21 to 280 (260 residues), 433 bits, see alignment E=4.1e-134 PF00528: BPD_transp_1" amino acids 85 to 272 (188 residues), 46.1 bits, see alignment E=2.5e-16

Best Hits

Swiss-Prot: 53% identical to CYSW_ECOL6: Sulfate transport system permease protein CysW (cysW) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 97% identity to vpe:Varpa_2697)

MetaCyc: 53% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>GFF1289 Sulfate transport system permease protein CysW (Variovorax sp. SCN45)
MSAPSKVIRRAQAGTTESAWVRWTLIGIALGFMFLFLVLPLAAVATEALRKGVTAYLDAL
KEPDAWSAIRLTLITAAIAVPLNLVFGVAAAWAVAKFEFRGKAFLTTLIDLPFAVSPVVA
GLIYVLVFGAQGWIGPWLADHDIKIIFAVPGIVLATVFVTFPFIARELIPLMQAQGTDEE
QAAIVLGATGWQTFWRVTLPNIKWGLLYGVILCNARAMGEFGAVSVVSGHIRGQTNTMPL
HVEVLYNEYQSVAAFAVASLLAILALVTLVIKSVIEWRHEREMKAIAELPPERPPETTAA