Protein Info for GFF1282 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Dephospho-CoA kinase (EC 2.7.1.24)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01121: CoaE
  • amino acids 1 to 150 (150 residues), 128.9 bits, E=9.1e-42
• TIGR00152: dephospho-CoA kinase
  • amino acids 1 to 154 (154 residues), 108.1 bits, E=2.5e-35

Best Hits

Swiss-Prot: 51% identical to COAE_RHOFT: Dephospho-CoA kinase (coaE) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K00859, dephospho-CoA kinase [EC: 2.7.1.24] (inferred from 54% identity to dia:Dtpsy_0765)

Predicted SEED Role

"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• coenzyme A biosynthesis I (bacteria) (4/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.24

Protein Sequence (169 amino acids)

>GFF1282 Dephospho-CoA kinase (EC 2.7.1.24) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VIDADAISRRSTEADGVAMPAIASVFGPAFLAPDGALDRQRMRDHVFANPEARHTLEHII
HPLVGAEIQRLAQASTSPCLVFDVPLLVESPRWRPQLDRVLVVDCSPATQIRRVNARSGW
DVSTTEAVMRNQSPRALRLAAADLVVFNDADDLSLLEHAAEALAKRFGL