Protein Info for GFF1282 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Phage major capsid protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF03864: Phage_cap_E" amino acids 5 to 341 (337 residues), 248.8 bits, see alignment E=4e-78

Best Hits

Swiss-Prot: 84% identical to HEAD_ECOL6: P21 prophage-derived major head protein (c1575) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to sec:SC1220)

Predicted SEED Role

"Phage major capsid protein" in subsystem Phage capsid proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>GFF1282 Phage major capsid protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MGLFTTRQLLGYTEQKVKFNPLFLSLFFRRTVTFPTQEVMLDKITGKTPIAAYVSPVVGG
KVLRNRGGETRVLRPGYVKPKHEVNYAQVVERLPGEDPARLNDPAYRRLRILTDNLKQEE
KAIVQVEEMQAVSAVLNGKYTMQGEQFDTVEVDFGRSAGNNIIQATGKKWSEQDRETFDP
TYDLDMYCDQASGLINIAVMDGKVWRLLNGFKLFREKLDTRRGSNSQLETAVKDLGAVVS
FKGYYGDLAIVVAKTSYVADNGTEKRYLPEGTLVLGNTAAEGIRCYGAIQDSQALAEGIV
AATRYPKHWLTVGDPANEYTMTQSAPLMVLPDPDEFVIVTVG