Protein Info for GFF1280 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 93 to 118 (26 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 17 to 124 (108 residues), 65 bits, see alignment E=3.5e-22 PF00528: BPD_transp_1" amino acids 37 to 222 (186 residues), 52.9 bits, see alignment E=1.9e-18

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 59% identity to srs:SerAS12_5015)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>GFF1280 ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines) (Variovorax sp. SCN45)
LIDLLREQLLAPRYLGWLLDGWLTTLWVSLLVSAGATVLGVFIAAGRSSSRPALLRATGA
YVSLFRNTPLLVQLFFWYFGAPAVLPEAVREWVYAGHVLSFELLSALVGLTLYAAAYVGE
DIRSGIRGVPAGQALAASALGFTRAQVMSQVVLPQALRIALPPLLGQYMNIVKNTSLAMA
VGLVELSYASRQVEAETFKTFQAFGFATLLYIATIGAIELLAAWTARRQGRPAWR