Protein Info for GFF1280 in Sphingobium sp. HT1-2

Annotation: Bll3966 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF02639: DUF188" amino acids 15 to 145 (131 residues), 143.3 bits, see alignment E=1.7e-46

Best Hits

Swiss-Prot: 75% identical to Y2376_SPHAL: UPF0178 protein Sala_2376 (Sala_2376) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K09768, hypothetical protein (inferred from 76% identity to sch:Sphch_3925)

Predicted SEED Role

"YaiI/YqxD family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>GFF1280 Bll3966 protein (Sphingobium sp. HT1-2)
MHILVDADACPVKEEIYKVAFRHGVPVTIVSNSPIRIPAHELIDRVVVSDGFDAADDWIA
ERAGADTLCITADILLADRCLKAGAGVIAPNGKSFTSASIGSAIAVRAIMADLRAGAVGD
PIGGPPPFSKTDRSRFLSALDEAIVRIKRGR