Protein Info for GFF1279 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Type IV fimbrial assembly, ATPase PilB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 TIGR02538: type IV-A pilus assembly ATPase PilB" amino acids 5 to 563 (559 residues), 806.8 bits, see alignment E=5.2e-247 PF05157: MshEN" amino acids 59 to 136 (78 residues), 54.7 bits, see alignment E=8.2e-19 PF00437: T2SSE" amino acids 175 to 559 (385 residues), 488.9 bits, see alignment E=7.9e-151

Best Hits

Swiss-Prot: 53% identical to TAPB_AERHY: Type IV pilus assembly protein TapB (tapB) from Aeromonas hydrophila

KEGG orthology group: K02652, type IV pilus assembly protein PilB (inferred from 81% identity to rfr:Rfer_2902)

Predicted SEED Role

"Type IV fimbrial assembly, ATPase PilB" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (564 amino acids)

>GFF1279 Type IV fimbrial assembly, ATPase PilB (Hydrogenophaga sp. GW460-11-11-14-LB1)
MALPGLGRALVSAGKLGQKAAEDLYRKAQSGRTSFIAELTGSGAVSASDLAHTMSVAFAA
PLLDLDAIDVQRLPAGLLDAKICADYRIVVLSKRNNRLMVATADPADQQAAEKIKFATQM
GVDWVIAEYDKLSKLVETQTTSVNDTMDNIIGGEFEFDEAATETNVSDVTDKASEVDDAP
VVKFLHKMLIDAFNMRASDLHFEPYEHNYRVRFRVDGELREIASPPIVIKDKLASRIKVI
SRMDISEKRVPQDGRMKLKIGPDRVIDFRVSTLPTLFGEKIVIRILDPSSAKVGIDALGY
EPEEKERLLNAIGRPYGMVLVTGPTGSGKTVSLYTCLNILNKPGINISTAEDPSEINLPG
VNQVNVNEKAGLTFAAALKAFLRQDPDVIMVGEIRDLETADISIKAAQTGHMVLSTLHTN
DAPTTLTRMMNMGIPTFNIASSVILITAQRLARRLCATCKAPLDAPRKALVDAGFKPEDL
DGTWTPYKPVGCSACNNGYKGRVGIYQVMPISEEIQRIILRGGSALDIAQQAGKEGVRTL
RESGLLKVKLGMTSLEEVLSVTNE