Protein Info for GFF1278 in Xanthobacter sp. DMC5

Annotation: putative D,D-dipeptide transport system permease protein DdpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 96 to 121 (26 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 156 to 173 (18 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details PF12911: OppC_N" amino acids 29 to 69 (41 residues), 29.6 bits, see alignment 5.1e-11 PF00528: BPD_transp_1" amino acids 110 to 294 (185 residues), 116.4 bits, see alignment E=1.3e-37

Best Hits

Swiss-Prot: 44% identical to DDPC_ECOLI: Probable D,D-dipeptide transport system permease protein DdpC (ddpC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 95% identity to xau:Xaut_4658)

MetaCyc: 38% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>GFF1278 putative D,D-dipeptide transport system permease protein DdpC (Xanthobacter sp. DMC5)
MTLATADTQKAPGGLAATLAHARYVISDNPVTGIAFGMFLVLVVCATFGPFIVPYDPLAS
DTAAALQPPSAAHWFGTDNLGRDIFSRVVVASRLDMAIAIFSVALVFAVGGVAGIASGFF
GGWTDRIIGRISDTIMAFPLFVLAMGIVAALGNTVTNIVIATAIINFPLYVRVAKSEAAI
RRNAGYVQAARLTGNSEWRILLTTILPNIMPIMMVQMSLTMGYAILNAAGLSFIGLGVRP
PTPEWGIMVAEGSAYIVSGEWWIALFPGLALMFAVFCFNLLGDGLRDIVDPQRRT