Protein Info for GFF1277 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Phage terminase, large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 PF05876: GpA_ATPase" amino acids 46 to 293 (248 residues), 182.4 bits, see alignment E=1.2e-57 PF20454: GpA_nuclease" amino acids 323 to 602 (280 residues), 218.1 bits, see alignment E=1.6e-68

Best Hits

Swiss-Prot: 82% identical to TERL_BPP21: Terminase, large subunit gp2 (2) from Enterobacteria phage P21

KEGG orthology group: None (inferred from 100% identity to see:SNSL254_A2815)

Predicted SEED Role

"Phage terminase, large subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (643 amino acids)

>GFF1277 Phage terminase, large subunit (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MISGERRANNANRAITNGLIALHIPVPLTTVQWADEYYYLPKESSYTPGKWETLPFQVAI
MNAMGYELIRVVNLIKSARVGYTKMLLGVEGYFIEHKSRNSLLFQPTDSSAEDFMKSHVE
PTIRDVPVLLELAPWFGRKHRDNTLTLKRFSSGVGFWCLGGAAAKNYREKSVDVVCYDEL
SSFEPDVEKEGSPTLLGDKRIEGSVWPKSIRGSTPKVKGSCQIEKAANESAHFMRFYVPC
PHCGEEQYLKFGDGSTPFGLKWEKSKPETVYYLCEHNGCVIRQSELDQKAGRWICDNTGM
WTRDGLAYFSASGEEVPPPRSITFHIWTAYSPFTTWIQIIYDWLDALKDPNGVKTFINTT
LGEPYEEAVAEKLSHELLLEKVIHYAAPVPERVVYLTAGIDSQRNRYEMYVWGWAPGEEA
FLIDKQIIMGRHDDEDTLQRVDAVINKKYRHADGTDISISRICWDIGGIDAEIVYKRSKK
HGIFRVLPVKGASVYGKPVITMPKKRNQSGVFLCEIGTDTAKEMLYARMGAVTAPADEAT
PYAIRFPDNPDVFTEVEAKQLVAEELVEKLVNGKFRLLWDAKGRRNEALDCLVYASAALR
VSVQRWQLDLEALATSRKSEEQDTPTLEQLAAMLAGGVNGNNH