Protein Info for PS417_06470 in Pseudomonas simiae WCS417

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 184 to 205 (22 residues), see Phobius details PF00672: HAMP" amino acids 201 to 250 (50 residues), 39.2 bits, see alignment 1.1e-13 PF00512: HisKA" amino acids 256 to 308 (53 residues), 36.6 bits, see alignment 5.6e-13 PF02518: HATPase_c" amino acids 354 to 458 (105 residues), 87 bits, see alignment E=1.9e-28

Best Hits

KEGG orthology group: None (inferred from 49% identity to bur:Bcep18194_C7107)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U5Z7 at UniProt or InterPro

Protein Sequence (461 amino acids)

>PS417_06470 histidine kinase (Pseudomonas simiae WCS417)
MRLLPRSLFGRLVLILVSGMLAAQALTSSIWYDRRHGQVLEIPARLIATRLADVVRLVHG
DPQQADLLIKMLDTPTFRLTLSDQASNTPSTLHDSDRPTERLIKKVLSEKTGYAQTLILL
RLSLVDGEGQTAGLSTLLGSKPVVGQFLIDLRLPDGRWLQVDASEEQGWTSTSPLDLLFD
YVMRIYLLRVLVLVLIALVAVRLAIRPLNALAKAAEALGRDIQRPPLSVDGPTEVRRAAQ
AFNAMQQRLIANIAERTRFLAAISHDLRSPITRLRLRTEMLEDNRTKERFRSDLEEMEQM
VASTLDFVSSGEINEARQNIDINALLQSLQADLQDVGENVVIEGRAKQPLPGYARSLKRC
VQNLLENAVRYGRDVTVRVEDQADSLTIIISDRGPGIPQAQLEQVMEPFYRVEGSRNAET
GGYGLGLSIAHTIAKAHDGRLSLRNREGGGLEAELRFQSKS