Protein Info for GFF1274 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Phage outer membrane lytic protein Rz; Endopeptidase (EC 3.4.-.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03245: Phage_lysis
  • amino acids 30 to 157 (128 residues), 97.5 bits, E=3.7e-32

Best Hits

Swiss-Prot: 45% identical to SPAN1_BP933: Spanin, inner membrane subunit (Rz) from Enterobacteria phage 933W

KEGG orthology group: K01423, [EC: 3.4.-.-] (inferred from 100% identity to stm:STM2611.S)

Predicted SEED Role

"Phage outer membrane lytic protein Rz; Endopeptidase (EC 3.4.-.-)" (EC 3.4.-.-)

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Protein Sequence (157 amino acids)

>GFF1274 Phage outer membrane lytic protein Rz; Endopeptidase (EC 3.4.-.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MMFNWKTMFVGLLLVSLIVAGRLANHYRNNAITYKYQRDTATHNLKLANETITDMTKRQR
DVAALDAKYTKELADAQNRNTDLQRRLAAGSRVRVEGRCTVPTTTTTKTASTRRVGNAAT
VELSPVAGQNVLDIRAGIISDQEKLKYLQEYIRTQCK