Protein Info for PS417_06455 in Pseudomonas simiae WCS417

Annotation: Fe(II)-dependent oxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13640: 2OG-FeII_Oxy_3
  • amino acids 84 to 176 (93 residues), 49.4 bits, E=7.5e-17
• PF18331: PKHD_C
  • amino acids 183 to 225 (43 residues), 64 bits, 1e-21

Best Hits

Swiss-Prot: 68% identical to Y7101_BURL3: PKHD-type hydroxylase Bcep18194_C7101 (Bcep18194_C7101) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K07336, PKHD-type hydroxylase [EC: 1.14.11.-] (inferred from 77% identity to pmk:MDS_3616)

Predicted SEED Role

"Iron-uptake factor PiuC" in subsystem Transport of Iron

KEGG Metabolic Maps

• Benzoxazinone biosynthesis
• Diterpenoid biosynthesis
• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.-

Sequence Analysis Tools

See U1TCS4 at UniProt or InterPro

Protein Sequence (226 amino acids)

>PS417_06455 Fe(II)-dependent oxygenase (Pseudomonas simiae WCS417)
MLIEIPALFSASEVDATVATLLDQPWVDGKVTAGPRSAMAKNNRQLSEDSPVAHRIGEQI
LARLSDNALFMSAALPKRIYPPLFNRYSGGEGFDWHIDNAIRGIKGVRERVRTDISATLF
LADPASYDGGELVIRDTFGEHAVKLPAGHLLIYPGSSLHKINPVTRGERIASFFWIESLV
REDSQRQLLLDMDVAIQTLTAQDADHHALLQLSGAYHNLLRRWSDG