Protein Info for GFF1270 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: DNA polymerase III theta subunit (EC 2.7.7.7)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 transmembrane" amino acids 82 to 102 (21 residues), see Phobius details PF06440: DNA_pol3_theta" amino acids 4 to 71 (68 residues), 116.9 bits, see alignment E=1.3e-38

Best Hits

KEGG orthology group: K02345, DNA polymerase III subunit theta [EC: 2.7.7.7] (inferred from 100% identity to stm:PSLT064)

Predicted SEED Role

"DNA polymerase III theta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>GFF1270 DNA polymerase III theta subunit (EC 2.7.7.7) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSGLNLAATTKEEQDKVAIDLVASGVVYKERLAMPVVAELVVREQPEHLREYFRARLEYL
RNSRTRMPRNMPEKRMRLKNSAIPDAFCLSLAGFYACRVMFFSGRGV