Protein Info for PS417_06445 in Pseudomonas simiae WCS417

Annotation: iron-siderophore ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 132 to 132 (1 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 260 to 284 (25 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details PF01032: FecCD" amino acids 33 to 347 (315 residues), 266.7 bits, see alignment E=1.2e-83

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 78% identity to pmk:MDS_3614)

Predicted SEED Role

"Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UH86 at UniProt or InterPro

Protein Sequence (352 amino acids)

>PS417_06445 iron-siderophore ABC transporter permease (Pseudomonas simiae WCS417)
MTTQTLDLASATHGYRRLLARRAWLLGLLGTALVSAILVDLASGPSGMGLLALLDGILHP
SHLSATDQVIIWNVRLPYALMAVLVGCALSLAGAEMQAILNNPLASPFTLGVSSAAALGA
SLVIVFPVTTLWVSANTAISISAFIFAAASVFLLQAMSRLRGAGVESLVLFGIALVFSCN
AVVALLQLVATEDVLQQLVFWTLGSVTRANWDKLGILALVVAVVLPFSFAAAPRLTLLRM
GEDRAQSFGVDVKRLRFFSLLRISLLSATAVAFVGTIGFIGLVGPHIARILVGEDQRFLL
PASALTGALLLALSSIASKLIMPGVIVPVGIVTALVGVPIFVVLVFKRGRQL