Protein Info for GFF1267 in Xanthobacter sp. DMC5

Annotation: Cytochrome c oxidase subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 59 to 83 (25 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details PF02790: COX2_TM" amino acids 38 to 124 (87 residues), 93.1 bits, see alignment E=9.7e-31 TIGR02866: cytochrome c oxidase, subunit II" amino acids 49 to 264 (216 residues), 212.7 bits, see alignment E=2e-67 PF00116: COX2" amino acids 136 to 255 (120 residues), 188.6 bits, see alignment E=3e-60

Best Hits

Swiss-Prot: 53% identical to COX2_RICFE: Probable cytochrome c oxidase subunit 2 (ctaC) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 81% identity to xau:Xaut_4648)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>GFF1267 Cytochrome c oxidase subunit 2 (Xanthobacter sp. DMC5)
MMSLIRTAARLRDAALAAGAFAAAMFASAGANAQMGQPAPWQINLQDAATPVMENIHHFN
VLLITIITAIVLFVLVLLVIVVVRFNERANPVPSKTSHNTLIEVAWTVVPVLILVAIAIP
SFRLLHLELNIPKPDLTVKVTGHQWYWSYEYPDNGGFGFDSYLVAEKDLKPGQPRLLAVD
NEVVVPINKNIRIQVTAADVIHSFAVPSFGVKIDAMPGRLNESWFKITREGVYYGQCSEL
CGRDHAFMPIAVRAVSEADFNAWVAQAKAKFASAKDAEGKFADAGNLEGAATAR