Protein Info for GFF1265 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Glutamyl-tRNA reductase (EC 1.2.1.70)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 244 to 265 (22 residues), see Phobius details TIGR01035: glutamyl-tRNA reductase" amino acids 5 to 406 (402 residues), 366.2 bits, see alignment E=1.1e-113 PF05201: GlutR_N" amino acids 6 to 155 (150 residues), 167.2 bits, see alignment E=3.3e-53 PF01488: Shikimate_DH" amino acids 171 to 305 (135 residues), 146.4 bits, see alignment E=9e-47 PF00745: GlutR_dimer" amino acids 319 to 418 (100 residues), 65.9 bits, see alignment E=5.3e-22

Best Hits

Swiss-Prot: 82% identical to HEM1_POLSJ: Glutamyl-tRNA reductase (hemA) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K02492, glutamyl-tRNA reductase [EC: 1.2.1.70] (inferred from 82% identity to pol:Bpro_0851)

Predicted SEED Role

"Glutamyl-tRNA reductase (EC 1.2.1.70)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>GFF1265 Glutamyl-tRNA reductase (EC 1.2.1.70) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSVWALGINHNTAPLDLRGRFAFALDQIQPTLHGYRQSLARQPEATLLSTCNRTELYGAG
DQSAVDPTLDWLAQTGGVSGQVLRDHAYILRDDQAARHAFRVASGLDSMVLGEAQILGQM
KDAVRAASDAGALGSTLHQLFQRSFAVAKEVRSSTEIGAHSISMTAAAVRLASQLFEDLR
DIRVLFVGAGEMIELAATHFAAKTPKGMAIANRTLERGEKLASRFGAQVMRLADVPDRLH
EFDAVISCTASTLPIIGLGAVERALKKRRHRPMFMVDLAVPRDIEVEVKALPDVYLYTVD
DLATVVQTGKEHRQAAVAQAEAIIDAGVLSFMHWMEQRDPAHGVVPLIQQINAQADEWRA
VEMARARRLLAKGEPVEAVLEALSRGLTQKMLHGTLAELHTGDSATRAATAHTVSRLFLR
DEPPKPPRNAQN