Protein Info for GFF1265 in Methylophilus sp. DMC18

Annotation: 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 3 to 312 (310 residues), 446.4 bits, see alignment E=2.7e-138 PF00108: Thiolase_N" amino acids 37 to 148 (112 residues), 40.2 bits, see alignment E=4e-14 PF08545: ACP_syn_III" amino acids 106 to 183 (78 residues), 109.7 bits, see alignment E=7.7e-36 PF08541: ACP_syn_III_C" amino acids 224 to 313 (90 residues), 132.1 bits, see alignment E=9.8e-43

Best Hits

Swiss-Prot: 67% identical to FABH_THIDA: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Thiobacillus denitrificans (strain ATCC 25259)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 78% identity to mmb:Mmol_1145)

MetaCyc: 59% identical to 3-oxoacyl-[acyl carrier protein] synthase 3 (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] S-acetyltransferase. [EC: 2.3.1.38]; Beta-ketoacyl-acyl-carrier-protein synthase III. [EC: 2.3.1.38, 2.3.1.180]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180 or 2.3.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>GFF1265 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1 (Methylophilus sp. DMC18)
MIYARIAGTGSYLPPHILTNADLEKMVDTTDEWIYARTGIKQRHRVTDERTSDLATNAAR
QAIDAAGIAAEQIDLIIVATTTPDKIFPSVATMVQRKLGISGCPAFDVQAVCSGFVYALT
TANQFIKSGQSRNVLVIGADTFTRITDYSDRSNCILWGDGAGAVILQASEQPGILSTHIH
ADGNYETYLHVPRNPDGPDTVVMEGNPVFKMAVNTLDQIVDETLEANQMQKSDIDWLVPH
QANIRILQATAKKLEMPMDKVVVTVDRHGNTSAASIPLALDVAVRDGRIQRGHTLLMEAF
GGGFTWGSVLVKY