Protein Info for GFF1263 in Pseudomonas sp. DMC3

Annotation: Multidrug resistance protein NorM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 144 to 161 (18 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 201 to 225 (25 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details amino acids 290 to 313 (24 residues), see Phobius details amino acids 327 to 350 (24 residues), see Phobius details amino acids 358 to 358 (1 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 400 to 422 (23 residues), see Phobius details amino acids 434 to 454 (21 residues), see Phobius details PF01554: MatE" amino acids 32 to 191 (160 residues), 132 bits, see alignment E=8.2e-43 amino acids 258 to 418 (161 residues), 124 bits, see alignment E=2.5e-40 TIGR00797: MATE efflux family protein" amino acids 32 to 427 (396 residues), 361 bits, see alignment E=3.7e-112

Best Hits

Swiss-Prot: 72% identical to PMPM_PSEAE: Multidrug resistance protein PmpM (pmpM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 94% identity to pfo:Pfl01_3887)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>GFF1263 Multidrug resistance protein NorM (Pseudomonas sp. DMC3)
VNPVTDQPVAVSLTRPARIRLELKNLLALALPIIIAQLATTAMGFVDAVMAGRVGPKDLA
AVALGNSIWVPVFLLMTGTLLATTPKVAQRFGAGKHSEIGPIVRQALWLALVVGLIATSM
LVAAEPVLHLMKVDPELISPCMQYLHGIASGLPAVAFYHVLRCTSDGIGRTRPAMVLGLC
GLALNIPLNYIFIYGHFGVPAMGGVGCGWATAIVMWVMALGLAGYERWAPAYRSSELFSR
FDWPQWAVIKRLLSIGLPIGIAVFAESSIFAVIALLIGSLGATVVAGHQIALNVSSLVFM
IPYSLGMAVTVRVGQALGREEPREARFAAGVGMGTALAYACLSASLMLALREPIAAIYTA
DPTVIHIAAMLIVYSALFQFSDAIQVTAAGALRGYQDTRVTMILTLFAYWGIGLPVGYAL
GLTDWLGEPRGPSGLWQGLIVGLSCAALMLSIRLTRSARKRIRISRSAG