Protein Info for PS417_06405 in Pseudomonas simiae WCS417

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 20 to 122 (103 residues), 55.2 bits, see alignment E=4.1e-19 PF00528: BPD_transp_1" amino acids 44 to 227 (184 residues), 66.2 bits, see alignment E=1.6e-22

Best Hits

Swiss-Prot: 60% identical to HISM_SALTI: Histidine transport system permease protein HisM (hisM) from Salmonella typhi

KEGG orthology group: K10015, histidine transport system permease protein (inferred from 96% identity to pfs:PFLU1309)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U865 at UniProt or InterPro

Protein Sequence (236 amino acids)

>PS417_06405 amino acid ABC transporter permease (Pseudomonas simiae WCS417)
MIELLQEYWRPFLYSDGQHITGLAMTMWLLTTALVIGFLVSIPLSIARVSRKRLVRWPVQ
FYTYLFRGTPLYIQLLICYTGIYSLAAVREQPLLDAFFRDAMNCTILAFALNTCAYTTEI
FAGAIRSMAHGEVEAAKAYGLSGWKLYAYVIMPSALRRSLPYYSNEVILMLHSTTVAFTA
TIPDILKVARDANSATFMTFQSFGIAALIYLTVTFALVGLFRLAERRWLAFLGPSH