Protein Info for PS417_06405 in Pseudomonas simiae WCS417
Annotation: amino acid ABC transporter permease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to HISM_SALTI: Histidine transport system permease protein HisM (hisM) from Salmonella typhi
KEGG orthology group: K10015, histidine transport system permease protein (inferred from 96% identity to pfs:PFLU1309)Predicted SEED Role
"Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7U865 at UniProt or InterPro
Protein Sequence (236 amino acids)
>PS417_06405 amino acid ABC transporter permease (Pseudomonas simiae WCS417) MIELLQEYWRPFLYSDGQHITGLAMTMWLLTTALVIGFLVSIPLSIARVSRKRLVRWPVQ FYTYLFRGTPLYIQLLICYTGIYSLAAVREQPLLDAFFRDAMNCTILAFALNTCAYTTEI FAGAIRSMAHGEVEAAKAYGLSGWKLYAYVIMPSALRRSLPYYSNEVILMLHSTTVAFTA TIPDILKVARDANSATFMTFQSFGIAALIYLTVTFALVGLFRLAERRWLAFLGPSH