Protein Info for GFF1261 in Pseudomonas sp. DMC3

Annotation: Ribosomal RNA large subunit methyltransferase M

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF18125: RlmM_FDX
  • amino acids 1 to 70 (70 residues), 66.9 bits, E=2.7e-22
• PF21239: RLMM_N
  • amino acids 82 to 157 (76 residues), 59.5 bits, E=4e-20
• PF01728: FtsJ
  • amino acids 181 to 273 (93 residues), 37.5 bits, E=3.7e-13

Best Hits

Swiss-Prot: 96% identical to RLMM_PSEPF: Ribosomal RNA large subunit methyltransferase M (rlmM) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K06968, ribosomal RNA large subunit methyltransferase M [EC: 2.1.1.-] (inferred from 96% identity to pfo:Pfl01_3889)

Predicted SEED Role

"LSU rRNA 2'-O-methyl-C2498 methyltransferase RlmM"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (357 amino acids)

>GFF1261 Ribosomal RNA large subunit methyltransferase M (Pseudomonas sp. DMC3)
MNTLFMHCRPGFEGEVCSEISDLAARLNVAGYAKAKTATACAEFVCTEADGAERLMRGQR
FAELIFPRQWARGFFIDLPENDRISVILAHMADFPVFGSLWLEVVDTNDGKELSNFCKKF
EGPLRKALTSAGKLVEDASKPRLLLTFKSGREVFLGMADAGNSAMWPMGIPRLKFPREAP
SRSTLKLEEAWHHFIPRDQWEDRLHSDMTGVDLGAAPGGWTWQLVNRGMLVTAIDNGPMA
ESLMETGLVQHLMADGFTFKPKQPVDWMVCDIVEKPARNAAMLEEWIGEGHCREAVVNLK
LPMKQRYAEVKRLLERIADGFKARGIKVDIGCKQLYHDREEVTCHLRRHDTRKTKSR