Protein Info for GFF126 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Possible GPH family transporter (TC 2.A.2) for arabinosides

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 21 to 21 (1 residues), see Phobius details amino acids 24 to 45 (22 residues), see Phobius details amino acids 67 to 84 (18 residues), see Phobius details amino acids 95 to 121 (27 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 352 to 376 (25 residues), see Phobius details amino acids 391 to 414 (24 residues), see Phobius details TIGR00792: sugar (Glycoside-Pentoside-Hexuronide) transporter" amino acids 1 to 431 (431 residues), 405.3 bits, see alignment E=1.4e-125 PF13347: MFS_2" amino acids 1 to 417 (417 residues), 313 bits, see alignment E=2.6e-97 PF07690: MFS_1" amino acids 10 to 332 (323 residues), 44.8 bits, see alignment E=8.5e-16

Best Hits

Swiss-Prot: 46% identical to YICJ_ECOLI: Inner membrane symporter YicJ (yicJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to see:SNSL254_A0162)

Predicted SEED Role

"Possible GPH family transporter (TC 2.A.2) for arabinosides" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>GFF126 Possible GPH family transporter (TC 2.A.2) for arabinosides (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MGDAGCNIIFGAIMLFVNYFYTDIFGLAPALVGVLLLSVRVIDAVTDPVMGALADRTQSK
YGRFRPWLLWIAFPYALFSVLMFTTPDWGYNSKVVYAFVTYFLLSVTYTAINIPYCSLGG
VITNDPKERVACQAYRFVLVGIATLLLSLTLLPMVDWFGGGDKAKGYQLAMTVLAIIGMG
MFLFCFASVRERVRPAVPTHDDMKNDFKDVWKNDQWVRILLLTLCNVCPGFIRMAATMYY
VTWVMGQSTHFATLFISLGVVGMMIGSMLAKVLTDRWCKLKVFFWTNIALAIFSCAFYFF
DPKATVMIVALYFLLNILHQIPSPLHWSLMADVDDYGEWKTGKRITGISFSGNLFFLKLG
LAIAGAMVGFLLSWYGYDASAKAQSASAMNGIMLLFTVIPGVGYLITAGVVRLLKVDREL
MKKIQDDLEKRRTNYRELSELQELNAAESVRKA