Protein Info for GFF1258 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Error-prone, lesion bypass DNA polymerase V (UmuC)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 PF00817: IMS" amino acids 6 to 149 (144 residues), 126.8 bits, see alignment E=9.8e-41 PF11799: IMS_C" amino acids 245 to 361 (117 residues), 89.5 bits, see alignment E=3e-29 PF13438: DUF4113" amino acids 372 to 420 (49 residues), 70.5 bits, see alignment 1.5e-23

Best Hits

Swiss-Prot: 100% identical to SAMB_SALTM: Protein SamB (samB) from Salmonella typhimurium

KEGG orthology group: K03502, DNA polymerase V (inferred from 99% identity to sec:SCV39)

MetaCyc: 63% identical to DNA polymerase V catalytic protein (Escherichia coli K-12 substr. MG1655)
DNA-directed DNA polymerase. [EC: 2.7.7.7]

Predicted SEED Role

"Error-prone, lesion bypass DNA polymerase V (UmuC)"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (424 amino acids)

>GFF1258 Error-prone, lesion bypass DNA polymerase V (UmuC) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MFALADVNSFYASCEKVFRPDLRDRSVVVLSNNDGCVIARSAEAKKLGIKMGVPWFQLRS
AKFPEPVIAFSSNYALYASMSNRVMVHLEELAPRVEQYSIDEMFLDIRGIDSCIDFEDFG
RQLREHVRSGTGLTIGVGMGPTKTLAKSAQWASKEWSQFGGVLALTLHNQKRTEKLLSLQ
PVEEIWGVGRRISKKLNTMGITTALQLARANPTFIRKNFNVVLERTVRELNGESCISLEE
APPPKQQIVCSRSFGERVTTYEAMRQAVCQHAERAAEKLRGERQFCRHIAVFVKTSPFAV
TEPYYGNLASEKLLIPTQDTRDIIAAAVRALDRIWVDGHRYAKAGCMLNDFTPTGVSQLN
LFDEVQPRERSEQLMQVLDGINHPGKGKIWFAGRGIAPEWQMKRELLSPAYTTRWADIPA
AKLT