Protein Info for PS417_06385 in Pseudomonas simiae WCS417

Annotation: DEAD/DEAH box helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 transmembrane" amino acids 170 to 190 (21 residues), see Phobius details TIGR04123: metallophosphoesterase, DNA ligase-associated" amino acids 6 to 213 (208 residues), 228.5 bits, see alignment E=2.8e-72 PF00149: Metallophos" amino acids 29 to 117 (89 residues), 24.1 bits, see alignment E=2.3e-09

Best Hits

KEGG orthology group: None (inferred from 87% identity to pfs:PFLU1305)

Predicted SEED Role

"FIG006285: ICC-like protein phosphoesterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYU5 at UniProt or InterPro

Protein Sequence (216 amino acids)

>PS417_06385 DEAD/DEAH box helicase (Pseudomonas simiae WCS417)
MLCTVELEGEELWLLADKAVYWPARQCLMIADAHFGKASAYRSLGQPVPQGTTTENLQRL
DRLLSALPCTQVIFLGDFLHGPGSHASGTLGALRSWRALNPDLPMTLIRGNHDKRAGDPP
EDLNINVVTEPLLIGPFALQHEPDAHPSHHVLAGHVHPVYRLRGKGRQSLRLPCFVIGVR
VSLLPAFGAFTGGHGVEQDNDRQIYVIGDHDVWPVG