Protein Info for PS417_06375 in Pseudomonas simiae WCS417

Annotation: deoxycytidine triphosphate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF22769: DCD
  • amino acids 3 to 161 (159 residues), 125 bits, E=3e-40
• TIGR02274: deoxycytidine triphosphate deaminase
  • amino acids 4 to 187 (184 residues), 169.9 bits, E=2.2e-54

Best Hits

Swiss-Prot: 98% identical to DCD_PSEFS: dCTP deaminase (dcd) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 98% identity to pfs:PFLU1304)

MetaCyc: 68% identical to dCTP deaminase (Rickettsia prowazekii Madrid E)
dCTP deaminase. [EC: 3.5.4.13]

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

See A0A1N7TWU1 at UniProt or InterPro

Protein Sequence (188 amino acids)

>PS417_06375 deoxycytidine triphosphate deaminase (Pseudomonas simiae WCS417)
MSIKSDKWIRRMAQEHGMIEPFVERQIRGQGDAPVISYGVSSYGYDVRCADEFKVFTNIN
SAIVDPKNFDEKSFVDVKSDVCIIPPNSFALARTVEFFRIPRDVLTICLGKSTYARCGII
VNVTPLEPEWEGHVTLEFSNTTTLPAKIYANEGVAQMLFLQSDEACEVSYKDRAGKYQGQ
RGVTLPRA