Protein Info for GFF1242 in Pseudomonas sp. DMC3

Annotation: RCS-specific HTH-type transcriptional activator RclR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF12852: Cupin_6" amino acids 25 to 213 (189 residues), 96.7 bits, see alignment E=2.3e-31 PF12833: HTH_18" amino acids 251 to 330 (80 residues), 69.1 bits, see alignment E=5e-23 PF00165: HTH_AraC" amino acids 293 to 326 (34 residues), 31.8 bits, see alignment 1.9e-11

Best Hits

KEGG orthology group: None (inferred from 79% identity to pba:PSEBR_a2163)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>GFF1242 RCS-specific HTH-type transcriptional activator RclR (Pseudomonas sp. DMC3)
MMRSLEILIETPNMSSIDSFSVSSDLITELLRSMRLRGVQYRRIHAGPPYGLGFSDKSGH
AYFHFVAAGSTVLRLEDGSLYELSAGNAVFIAHGAAHQLLSHAGAEVQDIDSAVAAPLGD
TVCAMQVGHSADLPDSALLFSGCMEFELGSLQGLGRLMPGLMLIDAGGQRYPGLMPILAT
MEREVSAARIGFAGILARLADVVAAMIVRGWVECACGNASGLVAALRDPRLAQALLALHQ
QPGRDWSVVELATLCNTSRSVFAERFQSTLGTPPLRYATELRMRLASQWLTLEKLPIEEV
AQRLGYTSQAAFSRAFKRITGSSPGASRRQR