Protein Info for GFF1241 in Xanthobacter sp. DMC5

Annotation: NADH-quinone oxidoreductase subunit J

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00499: Oxidored_q3
  • amino acids 18 to 168 (151 residues), 135.6 bits, E=5.5e-44

Best Hits

Swiss-Prot: 52% identical to NUOJ_RHOCA: NADH-quinone oxidoreductase subunit J (nuoJ) from Rhodobacter capsulatus

KEGG orthology group: K00339, NADH dehydrogenase I subunit J [EC: 1.6.5.3] (inferred from 87% identity to xau:Xaut_4624)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain J (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (202 amino acids)

>GFF1241 NADH-quinone oxidoreductase subunit J (Xanthobacter sp. DMC5)
MSVAAAFFYLFAFVLVASAFMVISSRNPVQSVLFLILAFVNAAGLFILIGAEFLALILVV
VYVGAVAVLFLFVVMMLDVDFVELRQGFLQYLPVGVVVGLIFLAELVLVVGAWVTGPGVS
SAVKSSPGGIATESNVRAIAQVLYTDYIYFFQAAGFVLLVAMIGAIVLTLRHKVNVRRQN
ITAQVTRSSTIEVVKVRPGQGL