Protein Info for GFF124 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Aromatic amino acid transport protein AroP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 358 to 379 (22 residues), see Phobius details amino acids 399 to 421 (23 residues), see Phobius details amino acids 427 to 445 (19 residues), see Phobius details PF00324: AA_permease" amino acids 18 to 452 (435 residues), 455.1 bits, see alignment E=2.8e-140 PF13520: AA_permease_2" amino acids 22 to 431 (410 residues), 131.5 bits, see alignment E=4.2e-42

Best Hits

Swiss-Prot: 100% identical to AROP_SALTI: Aromatic amino acid transport protein AroP (aroP) from Salmonella typhi

KEGG orthology group: K11734, aromatic amino acid transport protein AroP (inferred from 100% identity to seg:SG0152)

MetaCyc: 92% identical to aromatic amino acid:H+ symporter AroP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56; TRANS-RXN-76; TRANS-RXN-77

Predicted SEED Role

"Aromatic amino acid transport protein AroP" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>GFF124 Aromatic amino acid transport protein AroP (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDSQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAGPGIILGYAIAGFIAFL
IMRQLGEMVVEEPVAGSFSHFAYKYWGGFAGFASGWNYWVLYVLVAMAELTAVGKYIQFW
YPEIPTWASAAAFFVIINAINLTNVKVFGEMEFWFAIIKVIAVIAMILFGAWLLFSDTAG
PQATVRNLWEQGGFLPHGWTGLVMMMAIIMFSFGGLELVGITAAEADNPEQSIPKATNQV
IYRILIFYIGSLAVLLSLLPWTRVTADTSPFVLIFHELGDTFVANALNIVVLTAALSVYN
SCVYCNSRMLFGLAQQGNAPKALLNVDKRGVPVSSILVSAVVTALCVLLNYLAPESAFGL
LMALVVSALVINWAMISLAHMMFRRAKQQQGVKTRFPALFYPFGNVLCLLFMAAVLIIML
MTPGMAISVWLIPVWLLILGVGYLCKEKTAKTVKAH