Protein Info for GFF1239 in Variovorax sp. SCN45

Annotation: Two-component system sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 180 to 200 (21 residues), see Phobius details PF00672: HAMP" amino acids 199 to 254 (56 residues), 31.3 bits, see alignment 3.1e-11 PF00512: HisKA" amino acids 267 to 335 (69 residues), 57.7 bits, see alignment E=1.5e-19 PF02518: HATPase_c" amino acids 385 to 489 (105 residues), 87.2 bits, see alignment E=1.6e-28

Best Hits

KEGG orthology group: None (inferred from 89% identity to vpe:Varpa_2660)

Predicted SEED Role

"Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-)" in subsystem Potassium homeostasis (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (498 amino acids)

>GFF1239 Two-component system sensor histidine kinase (Variovorax sp. SCN45)
MFWSSLSRRLSAVFAVLLLVCCGASAWLQMRSNGIHEQEVVQRLSIGLAAHIAENSELMN
PDGLNQPAVKDLFDKLMAVNPSVEVYLLGLDGRIKAQAAPEGHLKRDTVGLEPIRKLLSG
APLPIGGDDPRSLTASKVFSAAPLRMDGRDVGYVYVVLQGEDHDALVANVATDNVLRTTL
WSMGLVALLGLLAGLAAFRLITRPLRELTAAVKRFETEGIASLESETPTLERLSRGTDEI
AQLGQAFTQMTRRIAEQWRELTLQDQQRRELFANISHDLRTPLTSLHGYLETLLLKAGSL
SEEERRRYLEIALGQSRKVGRLAQEVFELARLEYGVVKPEKENFALADLVQDVFQKFELA
AEARHQRLKPDIAPGLPVVSADLGMIERVLTNLLDNAIRHTPAGGEIVVQLRPENAGVTV
QVSDTGPGIPGELQKSLFMRPVFMSGSRTDSASSGGLGLVIVKRILQLHGSDIRLVQQPE
KGAVFRFQLGSAGSAAGA