Protein Info for GFF1237 in Xanthobacter sp. DMC5

Annotation: NADH-quinone oxidoreductase subunit N

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 105 to 122 (18 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 200 to 225 (26 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details amino acids 366 to 386 (21 residues), see Phobius details amino acids 391 to 421 (31 residues), see Phobius details amino acids 442 to 460 (19 residues), see Phobius details TIGR01770: proton-translocating NADH-quinone oxidoreductase, chain N" amino acids 10 to 464 (455 residues), 499 bits, see alignment E=8.2e-154 PF00361: Proton_antipo_M" amino acids 124 to 415 (292 residues), 294.4 bits, see alignment E=4.6e-92

Best Hits

Swiss-Prot: 80% identical to NUON_AZOC5: NADH-quinone oxidoreductase subunit N (nuoN) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K00343, NADH dehydrogenase I subunit N [EC: 1.6.5.3] (inferred from 92% identity to xau:Xaut_4620)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain N (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (476 amino acids)

>GFF1237 NADH-quinone oxidoreductase subunit N (Xanthobacter sp. DMC5)
MSQLLPPLGAVLPELVLAVSAIVLILIGAFRGEGSANLVTGLAIAVLAAAGVLVLLQPGT
EVSAFNGSLVIDPFGRFMKVLVSIGALVSLIMSVDWQAREKQAKFEYAVLVVIATLGMFM
LVSAGDLIALYLGLELMSLSLYVVAAINRDSVRSTEAGLKYFVLGALSSGMLLYGASLIY
GFTGSVNFLQIAAVAKEPSIGLIFGLVFLVAGLCFKVSAVPFHMWTPDVYEGAPTPVTAF
FASAPKVAGMAIFVRVLIEAFPHVSHQWQQIVAFVSLASMVLGAFAAIGQRNIKRLLAYS
SIGHMGFALVGLAAGTAEGVRGVLVYMAIYLMMTLGTFACVLTMRRKGQAVETVDDLAGL
ARRNPLMALMLGALMFSLAGIPPLAGFLAKYYVFVAAIQAGLYGLSVVGVLASVVGAFYY
LRIVKIMYFDEPVDAFDPMPTELKAVLAVSGLFTIFYFVYPAPLIEAASAAARSLF