Protein Info for GFF1223 in Xanthobacter sp. DMC5

Annotation: Na(+)/H(+) antiporter subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 transmembrane" amino acids 6 to 21 (16 residues), see Phobius details amino acids 28 to 51 (24 residues), see Phobius details amino acids 71 to 95 (25 residues), see Phobius details PF00420: Oxidored_q2" amino acids 6 to 103 (98 residues), 70.5 bits, see alignment E=4.2e-24

Best Hits

Swiss-Prot: 62% identical to PHAC1_RHIME: Probable K(+)/H(+) antiporter subunit C (phaC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05560, multicomponent K+:H+ antiporter subunit C (inferred from 77% identity to rpd:RPD_0675)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (116 amino acids)

>GFF1223 Na(+)/H(+) antiporter subunit C (Xanthobacter sp. DMC5)
MELLLAAGIGILTAVGLYLLLRAHTFPVILGLTFLSYAVNLFLFAMGRLAIDRPPVIVPD
ALAYTDPLPQALVLTAIVISFGMTALIVVLALRGFLETGSDSSHLDAPRGDKGDAP