Protein Info for GFF1222 in Pseudomonas sp. DMC3

Annotation: Acetoin catabolism regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 PF00989: PAS" amino acids 234 to 289 (56 residues), 29.7 bits, see alignment 1.9e-10 PF13426: PAS_9" amino acids 242 to 281 (40 residues), 24.9 bits, see alignment 7.3e-09 PF00158: Sigma54_activat" amino acids 332 to 496 (165 residues), 210.9 bits, see alignment E=3.6e-66 PF14532: Sigma54_activ_2" amino acids 347 to 501 (155 residues), 72.2 bits, see alignment E=1.9e-23 PF07728: AAA_5" amino acids 352 to 471 (120 residues), 33.2 bits, see alignment E=1.7e-11 PF02954: HTH_8" amino acids 587 to 622 (36 residues), 40.8 bits, see alignment 5e-14

Best Hits

KEGG orthology group: None (inferred from 57% identity to pfo:Pfl01_4988)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (629 amino acids)

>GFF1222 Acetoin catabolism regulatory protein (Pseudomonas sp. DMC3)
MKPASINAHARQVLQAVQGSVASHSAAADLAITRSWRRCLDQYQLDPASRRAPDVLEQAR
LREHRAPLEHIISVAHWQMNSLHQQLGRDGHVVLLTDARGVAIDSVFNEAERGEFQRSGL
WLGSVWSEEHEGTNGVGTCLVERQHVTIRRDEHFRGQHVGLTCSASPIFDASGELLAVLN
LSSVREDSSLEQRFKAMALTNLSARLIESCFFLGHDPQRYLLRFHPDAGFVGLLGEGLLS
FDESARICSVNAAALDLLGLSREQMVGQSLTMLLETPMEQLLDQASAQAHVCWPMRLADG
RLFYGQLREPIRSAPLTLAPVPPIKDERVCLEDSRLQRGFARALRVLERDVPVFLQGETG
TGKEAFAAALHRASSRAGQPFVAINCAAIPETLIESELFGYRGGSFTGARKDGMVGKLEQ
AHGGILFLDEIGDMPLALQTRLLRVLEERQVVPLGSATPRPLDVRLISASHQNLPACVAD
GRLREDLFYRIGGFAVELPPLRERSDKGRLLDLLLREEAAGATVRLQAGVRERLLAQPWP
GNVRQLRTCLRTLVALAVEGRVTLEDVHELLPASDDQPVDDPLGVSERQTLLSMIEAEHW
HVARVARRLGISRNTLYRKLRQHGITRPG