Protein Info for PS417_06205 in Pseudomonas simiae WCS417

Annotation: methionine aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 TIGR00500: methionine aminopeptidase, type I" amino acids 4 to 249 (246 residues), 325.9 bits, see alignment E=8.3e-102 PF00557: Peptidase_M24" amino acids 13 to 241 (229 residues), 190.2 bits, see alignment E=2e-60

Best Hits

Swiss-Prot: 63% identical to MAP1_SALTY: Methionine aminopeptidase (map) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 100% identity to pfs:PFLU1269)

MetaCyc: 62% identical to methionine aminopeptidase (Escherichia coli K-12 substr. MG1655)
Methionyl aminopeptidase. [EC: 3.4.11.18]

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.18

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U824 at UniProt or InterPro

Protein Sequence (262 amino acids)

>PS417_06205 methionine aminopeptidase (Pseudomonas simiae WCS417)
MTVSLKTAEDIAGMRIAGKLAADVLEMIAEHVKPGVTTETLNQICHDYIVNVQGAIPAPL
NYKGFPKSICTSVNHVVCHGIPGDKPLKDGDTLNIDVTVIKDRYFGDTSRMFHVGNVPVW
AERLSQVTQECMYKAIEIVKPGCRLGDIGEVIQKHAEKNGFSVVREFCGHGIGTVFHEEP
QILHYGRAGTGMELKAGMTFTIEPMINQGKADTKVLGDGWTAITKDRKLSAQWEHTLLVT
ETGYEIFTLRADDTIPRVSGAA