Protein Info for GFF1219 in Variovorax sp. SCN45

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF13489: Methyltransf_23" amino acids 33 to 209 (177 residues), 44.4 bits, see alignment E=7.7e-15 PF01135: PCMT" amino acids 34 to 123 (90 residues), 27.7 bits, see alignment E=1.1e-09 PF05175: MTS" amino acids 39 to 125 (87 residues), 33.8 bits, see alignment E=1.3e-11 PF01209: Ubie_methyltran" amino acids 47 to 158 (112 residues), 50.1 bits, see alignment E=1.2e-16 PF06325: PrmA" amino acids 50 to 127 (78 residues), 22.6 bits, see alignment E=3.3e-08 PF13847: Methyltransf_31" amino acids 52 to 168 (117 residues), 65 bits, see alignment E=3.4e-21 PF02390: Methyltransf_4" amino acids 54 to 135 (82 residues), 26.5 bits, see alignment E=2e-09 PF13649: Methyltransf_25" amino acids 54 to 149 (96 residues), 78.8 bits, see alignment E=2e-25 PF08242: Methyltransf_12" amino acids 55 to 151 (97 residues), 52.6 bits, see alignment E=3.2e-17 PF08241: Methyltransf_11" amino acids 55 to 152 (98 residues), 77 bits, see alignment E=7.3e-25

Best Hits

KEGG orthology group: None (inferred from 69% identity to vap:Vapar_1991)

Predicted SEED Role

"Methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>GFF1219 SAM-dependent methyltransferase (Variovorax sp. SCN45)
MEITKQNDDDEQARLWNGHAGHAWVDIQATLDQMFAPLAELLVEAASQLAAGRVLDIGCG
TGATTLALARLKNAQEGQCVGIDISAPMIDAAQKRAEKEGSRARFICADAQTHAFEAASF
DLLISRIGVMFFDDPVRAFANLRRAAKNGAALRFIAWRAAAENPFMTTAERAAAPLLPNL
PPRKPGAPGQFAFADSERIERILRDSGWQGIDIRPIDVACTLPEKDLLRYLSQLGPVGLQ
LRQEDEQTRARVIAAVRSAFEPYVHGDEVRFTAACWMVAAHAPVGSGNAG