Protein Info for GFF1215 in Variovorax sp. SCN45

Annotation: Oligopeptide transport ATP-binding protein @ Glutathione ABC transporter, ATP-binding protein GsiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 625 PF00005: ABC_tran" amino acids 34 to 198 (165 residues), 91.1 bits, see alignment E=3e-29 amino acids 346 to 495 (150 residues), 112.7 bits, see alignment E=6.5e-36 PF08352: oligo_HPY" amino acids 249 to 281 (33 residues), 31.1 bits, see alignment (E = 7.5e-11) amino acids 548 to 593 (46 residues), 32.2 bits, see alignment 3.4e-11

Best Hits

Swiss-Prot: 68% identical to GSIA_ECO57: Glutathione import ATP-binding protein GsiA (gsiA) from Escherichia coli O157:H7

KEGG orthology group: K13892, glutathione transport system ATP-binding protein (inferred from 96% identity to vpe:Varpa_2624)

MetaCyc: 68% identical to glutathione ABC transporter ATP binding subunit GsiA (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (625 amino acids)

>GFF1215 Oligopeptide transport ATP-binding protein @ Glutathione ABC transporter, ATP-binding protein GsiA (Variovorax sp. SCN45)
MSTPALALPDGRVLAVDDLTVRFSTSERTVDAVKKLSFHVDHGETLAVVGESGSGKSVTS
LALMRLVEHGGGRILGGSMAFRRRNGEVLDLAQARDSTMRGIRGADIAMIFQEPMTSLNP
VFTAGDQIAEAIRIHQGKSDSAARAEALRMLELVRIPEARNVLDRFPHQLSGGMRQRVMI
AMALSCKPQLLIADEPTTALDVTIQAQILQLIRELQKEMRMGVLFITHDMGVVAEIADRV
LVMYRGDKVEAGSSDTVFAAPQHPYTRALLSAVPKLGAMQGTDLPAKFDLLRTESPADAA
PPEPATPQDTVREDAGPILRVRDLVTRFDVRSGLFGRVKRRVHAVEKISFDLYPGETLAL
VGESGCGKSTTGRSLLRLVESQSGAIEFGGQNIRELPTRELQALRRNIQFIFQDPFASLD
PRVTVGFSIMEPLLIHGIAKGAEAQQRVDWLLQKVGLPPEVAQRYPHEFSGGQRQRIAIA
RALALNPKVVVADESVSALDVSIQAQIVNLMLDLQRELGVAFLFISHDMAVVERISHRVA
VMYLGQIVEIGPRRAVFEAPQHAYTRKLMAAVPVADPSRRHKPRALLEGEIPSPIRAVGD
EPEVPPLVQVAPGHFVARHAIGGAF