Protein Info for GFF1211 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Sulfate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 62 to 93 (32 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details amino acids 409 to 438 (30 residues), see Phobius details PF00916: Sulfate_transp" amino acids 27 to 404 (378 residues), 287.6 bits, see alignment E=1.3e-89 PF01740: STAS" amino acids 457 to 546 (90 residues), 47.1 bits, see alignment E=1.8e-16

Best Hits

KEGG orthology group: K03321, sulfate permease, SulP family (inferred from 68% identity to vap:Vapar_4088)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>GFF1211 Sulfate permease (Hydrogenophaga sp. GW460-11-11-14-LB1)
MFQGLPPLAPFRPRLLKDLQGYNREKFTRDVGAGATVGIVALPLAMAFAIASGLKPEAGL
WTAIIAGFLISALGGTSVQIGGPAGAFIVIVYGIVERYGVANLLIATASAGVLLFLLGLF
RLGTLVRYVPVSVVIGFTNGIAVLIALSQVRDVLGLEIARMPGSFFGQMKALAQHIDSFN
PFAFALGGLCVLGLFVWPRLWAVDFQFRRQIEKLDRVSALKATSRLPGPVVALVTLTLLA
WALSLPVETIGTRFGGIPQGTPTFELPDFSWETVRLLVTPTLTIALLGAIESLLCARVAD
QLGDAPKHDPNQELMAQGVANAVVPFFGGMPATGTIARTVTNIRSGAASPVAGMVHALTL
AAVVLVAAPLAYHIPLAVLAGVLLFVAWNMGEWREFGRLRQFSNHYRLMLLSTFFVTIVF
DLTVAVELGLVLAVVLFVRRQSEIFRAEPVARTEQQATYKLYGSLFFGAVAKIDPIVAEV
EQAPTPINVMLDASHMISLDTTGLDALEQLHKAVHKRGGHLGMVGLHAQPRSLIERSGFA
GRLNTFQ