Protein Info for GFF1211 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Kappa-fimbriae chaperone protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00345: PapD_N" amino acids 25 to 141 (117 residues), 120 bits, see alignment E=6.1e-39 PF02753: PapD_C" amino acids 164 to 225 (62 residues), 44.9 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 46% identical to FANE_ECOLX: Chaperone protein FanE (fanE) from Escherichia coli

KEGG orthology group: None (inferred from 99% identity to sei:SPC_p028)

Predicted SEED Role

"Kappa-fimbriae chaperone protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>GFF1211 Kappa-fimbriae chaperone protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VNKMMKWGLVSLLSLAVSGQAMAAFVLNGTRFIYEEGRKNTSFEVTNQADETFGGQVWID
NTTQGSSTVYMVPAPPFFKVRPKEKQIIRIMKTDSTLPSDRESLFWLNVQEIPPKPKASE
GNVLAVAVNTKVKLIYRPKALVEGRRNAEKNLQIAHRGGEAYLKNPTPYYFAVTGVKLNG
QPVRLNDRVMNEIAQLAPKSEVALGKLSLNGTVTVQAVNDWGGTQDYTLK