Protein Info for GFF1204 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Regulatory protein of benzoate catabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13560: HTH_31
  • amino acids 29 to 88 (60 residues), 33.1 bits, E=1.5e-11
• PF01381: HTH_3
  • amino acids 35 to 88 (54 residues), 35.1 bits, 2.7e-12
• PF13443: HTH_26
  • amino acids 35 to 90 (56 residues), 24 bits, E=9.8e-09
• PF01202: SKI
  • amino acids 147 to 296 (150 residues), 115.9 bits, E=4.8e-37

Best Hits

KEGG orthology group: K00891, shikimate kinase [EC: 2.7.1.71] (inferred from 76% identity to lch:Lcho_3658)

Predicted SEED Role

"Regulatory protein of benzoate catabolism" in subsystem Benzoate transport and degradation cluster

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• superpathway of chorismate metabolism (43/59 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.71

Use Curated BLAST to search for 2.7.1.71

Protein Sequence (315 amino acids)

>GFF1204 Regulatory protein of benzoate catabolism (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDIDATGVMAASEAKQPGAEEERHPFLVALGERVRTLRSRRGMTRKAVAVAADVSERHLA
NLEYGTGNASILVLLQVAQALQCSLAELLGDVSTSSPEWLLIRELLEKRNEADLRRARIA
IGSLLGGGAASGGDPGRKARIALIGLRGAGKSTLGQRLADDLGFTFIELSREIEKFAGCS
INEIHSLYGTPAYRRYERRALEEAIQIYPEVVIATPGGLVSDAANFNLLLSHCTTVWLQA
DPADHMGRVAAQGDLRPMAASREAMEDLKRILAGRSAFYSKADMAFDTSAYNLEDAFHAL
RAQVREAVGLDEKHA