Protein Info for GFF1201 in Variovorax sp. SCN45

Annotation: 4Fe-4S dicluster fused with DUF3470

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF12800: Fer4_4" amino acids 7 to 23 (17 residues), 13 bits, see alignment 4.6e-05 amino acids 37 to 52 (16 residues), 16.1 bits, see alignment 4.6e-06 PF12838: Fer4_7" amino acids 9 to 54 (46 residues), 27.2 bits, see alignment E=1.8e-09 PF00037: Fer4" amino acids 34 to 56 (23 residues), 29.1 bits, see alignment 2.5e-10 PF11953: DUF3470" amino acids 68 to 107 (40 residues), 61.2 bits, see alignment E=2.9e-20

Best Hits

Swiss-Prot: 62% identical to FER1_PSEPK: Ferredoxin 1 (fdxA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K05524, ferredoxin (inferred from 98% identity to vap:Vapar_2403)

Predicted SEED Role

"4Fe-4S ferredoxin, iron-sulfur binding"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>GFF1201 4Fe-4S dicluster fused with DUF3470 (Variovorax sp. SCN45)
MTHVVSEACIRCKYTDCVDVCPVDCFREGPNMLVIDPDECIDCAVCIPECPVNAIYAEED
LPANQIAFIKINAELAQADGWKSITKRKPALPDAEEWKDKTDKVGELVR