Protein Info for GFF12 in Variovorax sp. SCN45

Annotation: Two-component system sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 163 to 187 (25 residues), see Phobius details PF08521: 2CSK_N" amino acids 17 to 158 (142 residues), 26.9 bits, see alignment E=9.3e-10 PF00672: HAMP" amino acids 187 to 238 (52 residues), 38.4 bits, see alignment 2.6e-13 PF00512: HisKA" amino acids 243 to 309 (67 residues), 51.5 bits, see alignment E=1.7e-17 PF02518: HATPase_c" amino acids 361 to 468 (108 residues), 89.1 bits, see alignment E=5.4e-29

Best Hits

KEGG orthology group: K02484, two-component system, OmpR family, sensor kinase [EC: 2.7.13.3] (inferred from 63% identity to rso:RS02380)

Predicted SEED Role

"Sensor protein basS/pmrB (EC 2.7.3.-)" in subsystem Lipid A modifications or Orphan regulatory proteins (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>GFF12 Two-component system sensor histidine kinase (Variovorax sp. SCN45)
MLSFRRRLALAHVSVIVVVMTIAAFGSYFVFSRNVHGELDAALLALAETELGMLLSAGDG
DAVIVHEAPPGPAAPSFVRLDRLVQIVDADGRVLARSSNLGEAQLPIPPVLRERLAAGET
VFETLDGFGEEPTRMVSVPVPGRQKLLAVQVAGSLDDVNRTLGLASVLFLILGISLLLAL
AAAGALITRRAFGAIADVVQQARRISDANLGERLPHPGTRDEIGRLVDTLNDMLSRIENG
MEAQRRFTSDASHELRSPLSRLRTELELALRRPRDPADYVETLHSSLEEVESLTLLVEEL
LVLARIDAGQERDAAEKVSLNMLAEDAVRRLEPMARERRLSLVLEPSPPVAARVARGAAS
LALANLLDNALKFSPPGTVVSVSVRADLEANEAILSVSDHGPGIRGDELPHLFERFYRGA
TARSDEKTPGLGLGLALSQAVVHAHGGRIQAANEVGGGARFDMRLRLAR