Protein Info for GFF1194 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: DNA replication protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF02387: IncFII_repA" amino acids 13 to 278 (266 residues), 333.7 bits, see alignment E=4.1e-104 TIGR03474: incFII family plasmid replication initiator RepA" amino acids 15 to 288 (274 residues), 583 bits, see alignment E=3.7e-180

Best Hits

Swiss-Prot: 77% identical to REPA2_ECOLX: Replication initiation protein (repA) from Escherichia coli

KEGG orthology group: None (inferred from 100% identity to stm:PSLT006)

Predicted SEED Role

"DNA replication protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>GFF1194 DNA replication protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VQAEVTDTRTLFTHYRQVKNPNPEFTPREGKKTLPFCRKLMAKAEGFTSRFDFSVHVAFV
RSLGKRHRMPPLLRRRAIDALLQGLCFHYDPLANRVQRSITNLAIECGLATESKSGNLSI
TRATRALKFMAELGLITYQTEYDPQIGCNIPTDITFTPALFSALDVSDVAVMAARRSRVE
WENQQRKKQNLEPLEMDELIAKAWRFVRERFRSYQSERKLHGLKRARARRDADRSRKDIE
TLVKQQLTREYASGRFTGGLDAMKRELQRRVKERMMMSRGKNYTRLTMATVPI