Protein Info for GFF119 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Uncharacterized protein EC-HemY, likely associated with heme metabolism based on gene clustering with hemC, hemD in Proteobacteria (unrelated to HemY-type PPO in GramPositives)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details amino acids 29 to 29 (1 residues), see Phobius details transmembrane" amino acids 28 to 28 (1 residues), see Phobius details amino acids 49 to 67 (19 residues), see Phobius details TIGR00540: heme biosynthesis-associated TPR protein" amino acids 10 to 429 (420 residues), 209.7 bits, see alignment E=3e-66 PF07219: HemY_N" amino acids 36 to 123 (88 residues), 46.3 bits, see alignment E=2e-16

Best Hits

Predicted SEED Role

"Uncharacterized protein EC-HemY, likely associated with heme metabolism based on gene clustering with hemC, hemD in Proteobacteria (unrelated to HemY-type PPO in GramPositives)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>GFF119 Uncharacterized protein EC-HemY, likely associated with heme metabolism based on gene clustering with hemC, hemD in Proteobacteria (unrelated to HemY-type PPO in GramPositives) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAARFGGAMRSVFWLLGLAALAVALALLVGHNEATLTLFWPPYRFDVSFNFVVFCLIGGF
VLLYAALRAFSMLRDLPAQAQRWRSQQIERAVVGSVMDALSHQLAGRFVRAQAAAQQAVD
QLKGVSPGQWPRRDQLQLLSHLLLAESAQSLQNRERRDENLQAALNPKLARIAPEAHEGA
LLRAVRWAVEDRDAEAARARLAELPQGAGRRIQALRLKLRIARLGGETAEALETARVLAK
HRAFSPEASRSIVRGLALDALREAHDMAQLDTSWNGLDASERSMPELALAAARRANQLTG
PGVAEQERALASARVRAWLEPLWPEFGALDAAQQRQFVLALEPGLADLDAAGLARLEQLQ
RQWPQNGFLQYLAGQACLCRQLWGKAAQMLGQASHVLDDPALLRRTWRGLAQLAEERGDE
AAAQAAWKRAALLD