Protein Info for GFF1189 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: IncF plasmid conjugative transfer pilin acetylase TraX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 141 to 166 (26 residues), see Phobius details amino acids 177 to 194 (18 residues), see Phobius details amino acids 200 to 217 (18 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details TIGR02755: type-F conjugative transfer system pilin acetylase TraX" amino acids 23 to 246 (224 residues), 415.5 bits, see alignment E=3.6e-129 PF05857: TraX" amino acids 30 to 244 (215 residues), 204 bits, see alignment E=1.4e-64

Best Hits

Swiss-Prot: 72% identical to TRAX2_ECOLX: Protein TraX (traX) from Escherichia coli

KEGG orthology group: None (inferred from 99% identity to sec:SCV31)

Predicted SEED Role

"IncF plasmid conjugative transfer pilin acetylase TraX" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>GFF1189 IncF plasmid conjugative transfer pilin acetylase TraX (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTMDNATRNDSRAVRVDTRLQRLLAWSPGQRDLIKTVALLLMVADHINRILHLNQEWLFL
AGRGAFPLFALVWGLNLSQHTHIRQSAINRLWGWAVIAQSGYFLAGFPWYEGNILFAFAV
TAQALKWCEQRCLFHSAAALLLLTAWIPLSGTSYGVAGVLVLVICYRLYRTTDTEEHLAL
AACLVVAVPALNLVTSDAAAVAGLLVTGLTVWLVSLTGKSRPRFWPADFFPVFYTCHLAA
LGVLAM