Protein Info for GFF1188 in Xanthobacter sp. DMC5

Annotation: HTH-type transcriptional repressor ComR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 PF00440: TetR_N" amino acids 13 to 56 (44 residues), 49.9 bits, see alignment 3.4e-17 PF21993: TetR_C_13_2" amino acids 81 to 182 (102 residues), 30.2 bits, see alignment E=6.6e-11 PF16925: TetR_C_13" amino acids 85 to 177 (93 residues), 46.8 bits, see alignment E=5.4e-16

Best Hits

KEGG orthology group: None (inferred from 73% identity to xau:Xaut_0979)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>GFF1188 HTH-type transcriptional repressor ComR (Xanthobacter sp. DMC5)
MARPRAFNEGEVLDAALRCFWTRGYEATSVRDLASSMGLTGASLYNAFGDKRTLYEKALE
RYASHSMAERIRRLEAPDMAPRDAIATFFRETLERALDDPEMKGCFVVNAAVEMGPRDPE
LRAAALASLGEVEAFLTRRIEAGRTDGTIQSRETAQDLARMLLGVHLGLRVLARLRPGRE
LLEGVVKPALAALDP